PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009612981.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 314aa    MW: 35078.2 Da    PI: 7.6965
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009612981.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.4e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d++++ G+g +W + +++ g++R++k+c++rw++yl
   XP_009612981.1 14 KGPWSPEEDAKLKDYIEKSGTGgNWIALPQKAGLRRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding35.72e-1169111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++ eEd  +  + +  G++ W+ Ia  ++ gRt++++k++w++
   XP_009612981.1  69 GEFSDEEDRVICSLYASIGSR-WSIIAGQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.398962IPR017930Myb domain
SuperFamilySSF466891.04E-2611109IPR009057Homeodomain-like
SMARTSM007172.4E-111364IPR001005SANT/Myb domain
PfamPF002492.0E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-241569IPR009057Homeodomain-like
CDDcd001671.29E-81662No hitNo description
PROSITE profilePS5129421.67463117IPR017930Myb domain
SMARTSM007171.5E-1067115IPR001005SANT/Myb domain
PfamPF002498.5E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-2370117IPR009057Homeodomain-like
CDDcd001671.72E-770113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKDYIE KSGTGGNWIA LPQKAGLRRC GKSCRLRWLN  60
YLRPNIKHGE FSDEEDRVIC SLYASIGSRW SIIAGQLPGR TDNDIKNYWN TKLKKKLMGF  120
ASSSQKIRPF HHHHQHQITT GYSNYYPQIL PYSSPSTTLT TIAAYKYSNN TFPCYETIPT  180
IPSTSFLNTA AAASCTSGIT ASTSPLLQIQ ESNYVGPTTT TSSDGSAEYE NLDFHSYIYN  240
GVIGNEDQSN SKFLIEGGGK PMNGNGCYVE QQNPLDYSSL EEIKQLISSN NNVTCNSNLF  300
IDENKIEEKV MMYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ2285910.0JQ228591.1 Nicotiana tabacum ntrax mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009612981.10.0PREDICTED: transcription factor RAX2-like
TrEMBLH6WE870.0H6WE87_TOBAC; Ntrax
STRINGPGSC0003DMT4000050851e-136(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.16e-79myb domain protein 36